APBB3 antibody (70R-4577)

Rabbit polyclonal APBB3 antibody

Synonyms Polyclonal APBB3 antibody, Anti-APBB3 antibody, Amyloid Beta A4 Precursor Protein-Binding 3B antibody, MGC150555 antibody, MGC87674 antibody, SRA antibody, FE65L2 antibody
Cross Reactivity Human
Applications WB
Immunogen APBB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR
Assay Information APBB3 Blocking Peptide, catalog no. 33R-8950, is also available for use as a blocking control in assays to test for specificity of this APBB3 antibody

Images

Western Blot analysis using APBB3 antibody (70R-4577)

APBB3 antibody (70R-4577) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APBB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using APBB3 antibody (70R-4577) | APBB3 antibody (70R-4577) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors