ApoA-IV antibody (70R-5429)

Rabbit polyclonal ApoA-IV antibody raised against the C terminal of APOA4

Synonyms Polyclonal ApoA-IV antibody, Anti-ApoA-IV antibody, Apo AIV antibdoy, MGC142156 antibody, MGC142154 antibody, Apolipoprotein A lV antibody, Apolipoprotein A-Iv antibody, ApoA4 antibody
Specificity ApoA-IV antibody was raised against the C terminal of APOA4
Cross Reactivity Human
Applications WB
Immunogen ApoA-IV antibody was raised using the C terminal of APOA4 corresponding to a region with amino acids RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ
Assay Information ApoA-IV Blocking Peptide, catalog no. 33R-8122, is also available for use as a blocking control in assays to test for specificity of this ApoA-IV antibody


Western Blot analysis using ApoA-IV antibody (70R-5429)

ApoA-IV antibody (70R-5429) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The gene encoding APOA4 protein contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ApoA-IV antibody (70R-5429) | ApoA-IV antibody (70R-5429) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors