ApoB antibody (70R-7483)

Rabbit polyclonal ApoB antibody raised against the middle region of APOB

Synonyms Polyclonal ApoB antibody, Anti-ApoB antibody, FLDB antibody, Apolipoprotein B antibody
Specificity ApoB antibody was raised against the middle region of APOB
Cross Reactivity Human
Applications WB
Immunogen ApoB antibody was raised using the middle region of APOB corresponding to a region with amino acids SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV
Assay Information ApoB Blocking Peptide, catalog no. 33R-8668, is also available for use as a blocking control in assays to test for specificity of this ApoB antibody

Images

Immunohistochemical staining using ApoB antibody (70R-7483)

ApoB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 241 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using ApoB antibody (70R-7483) | ApoB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using ApoB antibody (70R-7483) | ApoB antibody (70R-7483) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using ApoB antibody (70R-7483) | ApoB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors