ApoBEC1 antibody (70R-4736)

Rabbit polyclonal ApoBEC1 antibody raised against the N terminal of APOBEC1

Synonyms Polyclonal ApoBEC1 antibody, Anti-ApoBEC1 antibody, APOBEC-1 antibody, CDAR1 antibody, Apolipoprotein B mRNA Editing Enzyme Catalytic Polypeptide 1 antibody, BEDP antibody, HEPR antibody
Specificity ApoBEC1 antibody was raised against the N terminal of APOBEC1
Cross Reactivity Human
Applications WB
Immunogen ApoBEC1 antibody was raised using the N terminal of APOBEC1 corresponding to a region with amino acids TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW
Assay Information ApoBEC1 Blocking Peptide, catalog no. 33R-9281, is also available for use as a blocking control in assays to test for specificity of this ApoBEC1 antibody

Images

Western Blot analysis using ApoBEC1 antibody (70R-4736)

ApoBEC1 antibody (70R-4736) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOBEC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance APOBEC1 is a member of the cytidine deaminase enzyme family. The protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ApoBEC1 antibody (70R-4736) | ApoBEC1 antibody (70R-4736) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors