ApoBEC2 antibody (70R-4928)

Rabbit polyclonal ApoBEC2 antibody raised against the middle region of APOBEC2

Synonyms Polyclonal ApoBEC2 antibody, Anti-ApoBEC2 antibody, ARCD1 antibody, Apolipoprotein B mRNA Editing Enzyme Catalytic Polypeptide-Like 2 antibody, ARP1 antibody
Specificity ApoBEC2 antibody was raised against the middle region of APOBEC2
Cross Reactivity Human
Applications WB
Immunogen ApoBEC2 antibody was raised using the middle region of APOBEC2 corresponding to a region with amino acids CKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADIL
Assay Information ApoBEC2 Blocking Peptide, catalog no. 33R-1724, is also available for use as a blocking control in assays to test for specificity of this ApoBEC2 antibody

Images

Western Blot analysis using ApoBEC2 antibody (70R-4928)

ApoBEC2 antibody (70R-4928) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOBEC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ApoBEC2 antibody (70R-4928) | ApoBEC2 antibody (70R-4928) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors