ApoBEC3B antibody (70R-4926)

Rabbit polyclonal ApoBEC3B antibody raised against the N terminal of APOBEC3B

Synonyms Polyclonal ApoBEC3B antibody, Anti-ApoBEC3B antibody, ARCD3 antibody, DJ742C19.2 antibody, ARP4 antibody, PHRBNL antibody, bK150C2.2 antibody, Apolipoprotein B mRNA Editing Enzyme Catalytic Polypeptide-Like 3B antibody, APOBEC1L antibody, FLJ21201 antibody
Specificity ApoBEC3B antibody was raised against the N terminal of APOBEC3B
Cross Reactivity Human
Applications WB
Immunogen ApoBEC3B antibody was raised using the N terminal of APOBEC3B corresponding to a region with amino acids NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW
Assay Information ApoBEC3B Blocking Peptide, catalog no. 33R-6841, is also available for use as a blocking control in assays to test for specificity of this ApoBEC3B antibody

Images

Western Blot analysis using ApoBEC3B antibody (70R-4926)

ApoBEC3B antibody (70R-4926) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOBEC3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance APOBEC3B is a member of the cytidine deaminase family. It is thought that these proteins may be RNA editing enzymes and have roles in growth or cell cycle control.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ApoBEC3B antibody (70R-4926) | ApoBEC3B antibody (70R-4926) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors