ApoBEC3D antibody (70R-4868)

Rabbit polyclonal ApoBEC3D antibody

Synonyms Polyclonal ApoBEC3D antibody, Anti-ApoBEC3D antibody, Apolipoprotein B mRNA Editing Enzyme Catalytic Polypeptide-Like 3D antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen ApoBEC3D antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE
Assay Information ApoBEC3D Blocking Peptide, catalog no. 33R-8959, is also available for use as a blocking control in assays to test for specificity of this ApoBEC3D antibody


Immunohistochemical staining using ApoBEC3D antibody (70R-4868)

ApoBEC3D antibody was used for immunohistochemistry at a concentration of 12.0 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOBEC3D antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 12 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ApoBEC3D antibody (70R-4868) | ApoBEC3D antibody was used for immunohistochemistry at a concentration of 12.0 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using ApoBEC3D antibody (70R-4868) | ApoBEC3D antibody (70R-4868) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors