ApoBEC3F antibody (70R-4925)

Rabbit polyclonal ApoBEC3F antibody raised against the C terminal of APOBEC3F

Synonyms Polyclonal ApoBEC3F antibody, Anti-ApoBEC3F antibody, KA6 antibody, BK150C2.4.MRNA antibody, Apolipoprotein B mRNA Editing Enzyme Catalytic Polypeptide-Like 3F antibody, ARP8 antibody, MGC74891 antibody
Specificity ApoBEC3F antibody was raised against the C terminal of APOBEC3F
Cross Reactivity Human
Applications WB
Immunogen ApoBEC3F antibody was raised using the C terminal of APOBEC3F corresponding to a region with amino acids ASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE
Assay Information ApoBEC3F Blocking Peptide, catalog no. 33R-1538, is also available for use as a blocking control in assays to test for specificity of this ApoBEC3F antibody


Western Blot analysis using ApoBEC3F antibody (70R-4925)

ApoBEC3F antibody (70R-4925) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOBEC3F antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance APOBEC3F is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ApoBEC3F antibody (70R-4925) | ApoBEC3F antibody (70R-4925) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors