ApoBEC3G antibody (70R-5889)

Rabbit polyclonal ApoBEC3G antibody raised against the N terminal of APOBEC3G

Synonyms Polyclonal ApoBEC3G antibody, Anti-ApoBEC3G antibody, Apolipoprotein B mRNA Editing Enzyme Catalytic Polypeptide-Like 3G antibody
Specificity ApoBEC3G antibody was raised against the N terminal of APOBEC3G
Cross Reactivity Human
Applications IHC, WB
Immunogen ApoBEC3G antibody was raised using the N terminal of APOBEC3G corresponding to a region with amino acids AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC

Images

Immunohistochemical staining using ApoBEC3G antibody (70R-5889)

ApoBEC3G antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOBEC3G antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using ApoBEC3G antibody (70R-5889) | ApoBEC3G antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X
  • Western Blot analysis using ApoBEC3G antibody (70R-5889) | ApoBEC3G antibody (70R-5889) used at 2 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors