ApoH antibody (70R-3219)

Rabbit polyclonal ApoH antibody

Synonyms Polyclonal ApoH antibody, Anti-ApoH antibody, Beta 2 glycoprotein I antibody, B2G1 antibody, Apolipoprotein H antibody, BG antibody
Cross Reactivity Human
Applications WB
Immunogen ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHG
Assay Information ApoH Blocking Peptide, catalog no. 33R-7270, is also available for use as a blocking control in assays to test for specificity of this ApoH antibody


Western Blot analysis using ApoH antibody (70R-3219)

ApoH antibody (70R-3219) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ApoH antibody (70R-3219) | ApoH antibody (70R-3219) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors