ApoH antibody (70R-5421)

Rabbit polyclonal ApoH antibody

Synonyms Polyclonal ApoH antibody, Anti-ApoH antibody, B2G1 antibody, Apolipoprotein H antibody, Beta 2 glycoprotein I antibody, BG antibody
Cross Reactivity Human,Dog
Applications WB
Immunogen ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD
Assay Information ApoH Blocking Peptide, catalog no. 33R-5558, is also available for use as a blocking control in assays to test for specificity of this ApoH antibody


Western Blot analysis using ApoH antibody (70R-5421)

ApoH antibody (70R-5421) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ApoH antibody (70R-5421) | ApoH antibody (70R-5421) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors