APP antibody (70R-6195)

Rabbit polyclonal APP antibody raised against the middle region of APP

Synonyms Polyclonal APP antibody, Anti-APP antibody, CTFgamma antibody, APPI antibody, CVAP antibody, ABPP antibody, Amyloid Precursor Protein antibody, PN2 antibody, ABETA antibody, AD1 antibody, AAA antibody
Specificity APP antibody was raised against the middle region of APP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen APP antibody was raised using the middle region of APP corresponding to a region with amino acids DPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQV
Assay Information APP Blocking Peptide, catalog no. 33R-2119, is also available for use as a blocking control in assays to test for specificity of this APP antibody

Images

Western blot analysis using APP antibody (70R-6195)

Recommended APP Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 85 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using APP antibody (70R-6195) | Recommended APP Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors