APRT Blocking Peptide (33R-1105)

A synthetic peptide for use as a blocking control in assays to test for specificity of APRT antibody, catalog no. 70R-3109

Synonyms APRT control peptide, APRT antibody Blocking Peptide, Anti-APRT Blocking Peptide, Adenine Phosphoribosyltransferase Blocking Peptide, AMP Blocking Peptide, DKFZp686D13177 Blocking Peptide, MGC125856 Blocking Peptide, MGC125857 Blocking Peptide, MGC129961 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK
Molecular Weight 20 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Adenine phosphoribosyltransferase (APRT) belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors