Aquaporin 10 antibody (70R-7451)

Rabbit polyclonal Aquaporin 10 antibody raised against the middle region of AQP10

Synonyms Polyclonal Aquaporin 10 antibody, Anti-Aquaporin 10 antibody, AQP10 antibody, AQPA_HUMAN antibody
Specificity Aquaporin 10 antibody was raised against the middle region of AQP10
Cross Reactivity Human
Applications WB
Immunogen Aquaporin 10 antibody was raised using the middle region of AQP10 corresponding to a region with amino acids VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK
Assay Information Aquaporin 10 Blocking Peptide, catalog no. 33R-9547, is also available for use as a blocking control in assays to test for specificity of this Aquaporin 10 antibody

Images

Western Blot analysis using Aquaporin 10 antibody (70R-7451)

Aquaporin 10 antibody (70R-7451) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AQP10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AQP10 is a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. AQP10 was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Aquaporin 10 antibody (70R-7451) | Aquaporin 10 antibody (70R-7451) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors