ARC antibody (70R-4422)

Rabbit polyclonal ARC antibody raised against the middle region of ARC

Synonyms Polyclonal ARC antibody, Anti-ARC antibody, Activity-Regulated Cytoskeleton-Associated Protein antibody, KIAA0278 antibody
Specificity ARC antibody was raised against the middle region of ARC
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ARC antibody was raised using the middle region of ARC corresponding to a region with amino acids ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF
Assay Information ARC Blocking Peptide, catalog no. 33R-2534, is also available for use as a blocking control in assays to test for specificity of this ARC antibody


Western Blot analysis using ARC antibody (70R-4422)

ARC antibody (70R-4422) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ARC antibody (70R-4422) | ARC antibody (70R-4422) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors