ARF1 antibody (70R-5876)

Rabbit polyclonal ARF1 antibody raised against the middle region of ARF1

Synonyms Polyclonal ARF1 antibody, Anti-ARF1 antibody, Adp-Ribosylation Factor 1 antibody
Specificity ARF1 antibody was raised against the middle region of ARF1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ARF1 antibody was raised using the middle region of ARF1 corresponding to a region with amino acids MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA
Assay Information ARF1 Blocking Peptide, catalog no. 33R-6371, is also available for use as a blocking control in assays to test for specificity of this ARF1 antibody

Images

Western Blot analysis using ARF1 antibody (70R-5876)

ARF1 antibody (70R-5876) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADP-ribosylation factor 1 (ARF1) is a member of the human ARF family. The family is composed of small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. These protein, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ARF1 antibody (70R-5876) | ARF1 antibody (70R-5876) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors