ARF6 antibody (70R-5721)

Rabbit polyclonal ARF6 antibody raised against the middle region of ARF6

Synonyms Polyclonal ARF6 antibody, Anti-ARF6 antibody, DKFZp564M0264 antibody, Adp-Ribosylation Factor 6 antibody
Specificity ARF6 antibody was raised against the middle region of ARF6
Cross Reactivity Human,Mouse,Rat,Drosophila
Applications WB
Immunogen ARF6 antibody was raised using the middle region of ARF6 corresponding to a region with amino acids REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG
Assay Information ARF6 Blocking Peptide, catalog no. 33R-7882, is also available for use as a blocking control in assays to test for specificity of this ARF6 antibody


Western blot analysis using ARF6 antibody (70R-5721)

Recommended ARF6 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARF6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARF6 is a member of the human ARF family, which is part of the RAS superfamily. They are small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. ARF6 is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using ARF6 antibody (70R-5721) | Recommended ARF6 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using ARF6 antibody (70R-5721) | Paraffin embedded brain, cerebellum tissue, tested with an antibody Dilution of 5 ug/ml.

Availability: In stock

Price: $375.00
Size: 50 ug
View Our Distributors