ARFGAP3 Blocking Peptide (33R-10325)

A synthetic peptide for use as a blocking control in assays to test for specificity of ARFGAP3 antibody, catalog no. 70R-10382

Synonyms ARFGAP3 control peptide, ARFGAP3 antibody Blocking Peptide, Anti-ARFGAP3 Blocking Peptide, ADP-ribosylation factor GTPase activating protein 3 Blocking Peptide, ARFGAP1 Blocking Peptide, FLJ45618 Blocking Peptide, ARFGAP3, ARFGAP-3, ARFGAP 3, ARFGAP-3 Blocking Peptide, ARFGAP 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues FHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVP
Molecular Weight 57 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a GTPase-activating protein (GAP) that associates with the Golgi apparatus and regulates the early secretory pathway of proteins. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1 (ARF1)-bound GTP, which is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is a prerequisite for the fusion of these vesicles with target compartments. The activity of this protein is sensitive to phospholipids. Multiple transcript variants encoding different isoforms have been found for this gene. This gene was originally known as ARFGAP1, but that is now the name of a related but different gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors