ARHGAP15 antibody (70R-4375)

Rabbit polyclonal ARHGAP15 antibody raised against the middle region of ARHGAP15

Synonyms Polyclonal ARHGAP15 antibody, Anti-ARHGAP15 antibody, BM046 antibody, Rho Gtpase Activating Protein 15 antibody
Specificity ARHGAP15 antibody was raised against the middle region of ARHGAP15
Cross Reactivity Human
Applications WB
Immunogen ARHGAP15 antibody was raised using the middle region of ARHGAP15 corresponding to a region with amino acids VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ
Assay Information ARHGAP15 Blocking Peptide, catalog no. 33R-9637, is also available for use as a blocking control in assays to test for specificity of this ARHGAP15 antibody

Images

Western Blot analysis using ARHGAP15 antibody (70R-4375)

ARHGAP15 antibody (70R-4375) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARHGAP15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RHO GTPases regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ARHGAP15 antibody (70R-4375) | ARHGAP15 antibody (70R-4375) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors