ARHGAP30 antibody (70R-3999)

Rabbit polyclonal ARHGAP30 antibody raised against the N terminal of ARHGAP30

Synonyms Polyclonal ARHGAP30 antibody, Anti-ARHGAP30 antibody, FLJ44128 antibody, FLJ00267 antibody, RP11-544M22.6 antibody, Rho Gtpase Activating Protein 30 antibody
Specificity ARHGAP30 antibody was raised against the N terminal of ARHGAP30
Cross Reactivity Human
Applications WB
Immunogen ARHGAP30 antibody was raised using the N terminal of ARHGAP30 corresponding to a region with amino acids RKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAG
Assay Information ARHGAP30 Blocking Peptide, catalog no. 33R-8013, is also available for use as a blocking control in assays to test for specificity of this ARHGAP30 antibody


Western Blot analysis using ARHGAP30 antibody (70R-3999)

ARHGAP30 antibody (70R-3999) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARHGAP30 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARHGAP30 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ARHGAP30 antibody (70R-3999) | ARHGAP30 antibody (70R-3999) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors