ARHGDIG antibody (70R-6038)

Rabbit polyclonal ARHGDIG antibody

Synonyms Polyclonal ARHGDIG antibody, Anti-ARHGDIG antibody, Rho Gdp Dissociation Inhibitor antibody, Gdi Gamma antibody
Cross Reactivity Human
Applications WB
Immunogen ARHGDIG antibody was raised using a synthetic peptide corresponding to a region with amino acids DEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPN
Assay Information ARHGDIG Blocking Peptide, catalog no. 33R-1892, is also available for use as a blocking control in assays to test for specificity of this ARHGDIG antibody

Images

Western Blot analysis using ARHGDIG antibody (70R-6038)

ARHGDIG antibody (70R-6038) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARHGDIG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARHGDIG is highly expressed in the entire brain, with regional variations. The mRNA is also present at high levels in kidney and pancreas and at moderate levels in spinal cord, stomach, and pituitary gland. ARHGDIG is mapped to chromosome band 16p13.3 which is rich in deletion mutants of genes involved in several human diseases, notably polycystic kidney disease, alpha-thalassemia, tuberous sclerosis, mental retardation, and cancer.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ARHGDIG antibody (70R-6038) | ARHGDIG antibody (70R-6038) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors