ARHGEF19 antibody (70R-4538)

Rabbit polyclonal ARHGEF19 antibody

Synonyms Polyclonal ARHGEF19 antibody, Anti-ARHGEF19 antibody, Gef 19 antibody, WGEF antibody, Rho RNA guanine Nucleotide Exchange Factor antibody, RP4-733M16.1 antibody, FLJ33962 antibody
Cross Reactivity Human
Applications WB
Immunogen ARHGEF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS
Assay Information ARHGEF19 Blocking Peptide, catalog no. 33R-7904, is also available for use as a blocking control in assays to test for specificity of this ARHGEF19 antibody

Images

Western Blot analysis using ARHGEF19 antibody (70R-4538)

ARHGEF19 antibody (70R-4538) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 89 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARHGEF19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Guanine nucleotide exchange factors (GEFs) such as ARHGEF19 accelerate the GTPase activity of Rho GTPases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ARHGEF19 antibody (70R-4538) | ARHGEF19 antibody (70R-4538) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors