ARL11 antibody (70R-3718)

Rabbit polyclonal ARL11 antibody raised against the middle region of ARL11

Synonyms Polyclonal ARL11 antibody, Anti-ARL11 antibody, ARLTS1 antibody, MGC17429 antibody, FLJ33930 antibody, Adp-Ribosylation Factor-Like 11 antibody
Specificity ARL11 antibody was raised against the middle region of ARL11
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ARL11 antibody was raised using the middle region of ARL11 corresponding to a region with amino acids WKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANK
Assay Information ARL11 Blocking Peptide, catalog no. 33R-9959, is also available for use as a blocking control in assays to test for specificity of this ARL11 antibody

Images

Western Blot analysis using ARL11 antibody (70R-3718)

ARL11 antibody (70R-3718) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARL11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARL11 belongs to the small GTPase superfamily, Arf family. It may play a role in apoptosis and act as a tumor suppressor. Defects in ARL11 may be a cause of susceptibility to chronic lymphocytic leukemia (CLL).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ARL11 antibody (70R-3718) | ARL11 antibody (70R-3718) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors