ARL17 antibody (70R-3805)

Rabbit polyclonal ARL17 antibody raised against the middle region of ARL17

Synonyms Polyclonal ARL17 antibody, Anti-ARL17 antibody, ARL17B antibody, Adp-Ribosylation Factor-Like 17 antibody
Specificity ARL17 antibody was raised against the middle region of ARL17
Cross Reactivity Human
Applications WB
Immunogen ARL17 antibody was raised using the middle region of ARL17 corresponding to a region with amino acids KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD
Assay Information ARL17 Blocking Peptide, catalog no. 33R-4276, is also available for use as a blocking control in assays to test for specificity of this ARL17 antibody


Western Blot analysis using ARL17 antibody (70R-3805)

ARL17 antibody (70R-3805) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARL17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ARL17 antibody (70R-3805) | ARL17 antibody (70R-3805) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors