ARL5A antibody (70R-5715)

Rabbit polyclonal ARL5A antibody raised against the middle region of ARL5A

Synonyms Polyclonal ARL5A antibody, Anti-ARL5A antibody, ARL5 antibody, Adp-Ribosylation Factor-Like 5A antibody, ARFLP5 antibody
Specificity ARL5A antibody was raised against the middle region of ARL5A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ARL5A antibody was raised using the middle region of ARL5A corresponding to a region with amino acids YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA
Assay Information ARL5A Blocking Peptide, catalog no. 33R-10153, is also available for use as a blocking control in assays to test for specificity of this ARL5A antibody


Western Blot analysis using ARL5A antibody (70R-5715)

ARL5A antibody (70R-5715) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARL5A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ARL5A antibody (70R-5715) | ARL5A antibody (70R-5715) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors