ARL6IP1 Blocking Peptide (33R-10386)

A synthetic peptide for use as a blocking control in assays to test for specificity of ARL6IP1 antibody, catalog no. 70R-10329

Synonyms ARL6IP1 control peptide, ARL6IP1 antibody Blocking Peptide, Anti-ARL6IP1 Blocking Peptide, ADP-ribosylation factor-like 6 interacting protein 1 Blocking Peptide, AIP1 Blocking Peptide, ARL6IP Blocking Peptide, ARMER Blocking Peptide, KIAA0069 Blocking Peptide, ARL6IP1, ARLIP1-6, ARLIP1 6, ARLIP1-6 Blocking Peptide, ARLIP1 6 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE
Molecular Weight 22 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARL6IP1 may be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors