ARL6IP2 antibody (70R-5948)

Rabbit polyclonal ARL6IP2 antibody raised against the C terminal of ARL6IP2

Synonyms Polyclonal ARL6IP2 antibody, Anti-ARL6IP2 antibody, ATL2 antibody, Adp-Ribosylation Factor-Like 6 Interacting Protein 2 antibody, ARL3IP2 antibody, FLJ23293 antibody, atlastin2 antibody
Specificity ARL6IP2 antibody was raised against the C terminal of ARL6IP2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ARL6IP2 antibody was raised using the C terminal of ARL6IP2 corresponding to a region with amino acids MEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQ
Assay Information ARL6IP2 Blocking Peptide, catalog no. 33R-5950, is also available for use as a blocking control in assays to test for specificity of this ARL6IP2 antibody

Images

Western Blot analysis using ARL6IP2 antibody (70R-5948)

ARL6IP2 antibody (70R-5948) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARL6IP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARL6IP2 is a multi-pass membrane proteinPotential. It belongs to the GBP family. Atlastin GTPases are required for Golgi apparatus and ER morphogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ARL6IP2 antibody (70R-5948) | ARL6IP2 antibody (70R-5948) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors