ARL8A antibody (70R-5793)

Rabbit polyclonal ARL8A antibody raised against the middle region of ARL8A

Synonyms Polyclonal ARL8A antibody, Anti-ARL8A antibody, ARL10B antibody, Adp-Ribosylation Factor-Like 8A antibody, FLJ45195 antibody, GIE2 antibody
Specificity ARL8A antibody was raised against the middle region of ARL8A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ARL8A antibody was raised using the middle region of ARL8A corresponding to a region with amino acids IGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQ
Assay Information ARL8A Blocking Peptide, catalog no. 33R-3970, is also available for use as a blocking control in assays to test for specificity of this ARL8A antibody

Images

Western blot analysis using ARL8A antibody (70R-5793)

Recommended ARL8A Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARL8A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARL8A belongs to the small GTPase superfamily, Arf family. ARL8A m,ay play a role in lysosomes motility. Alternatively, may play a role in chromosomes segregation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using ARL8A antibody (70R-5793) | Recommended ARL8A Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors