ARL8B antibody (70R-3486)

Rabbit polyclonal ARL8B antibody raised against the middle region of ARL8B

Synonyms Polyclonal ARL8B antibody, Anti-ARL8B antibody, Gie1 antibody, FLJ10702 antibody, ARL10C antibody, Adp-Ribosylation Factor-Like 8B antibody
Specificity ARL8B antibody was raised against the middle region of ARL8B
Cross Reactivity Human
Applications WB
Immunogen ARL8B antibody was raised using the middle region of ARL8B corresponding to a region with amino acids DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL
Assay Information ARL8B Blocking Peptide, catalog no. 33R-1997, is also available for use as a blocking control in assays to test for specificity of this ARL8B antibody

Images

Western Blot analysis using ARL8B antibody (70R-3486)

ARL8B antibody (70R-3486) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARL8B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARL8B may play a role in lysosome motility and chromosome segregation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ARL8B antibody (70R-3486) | ARL8B antibody (70R-3486) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors