ARMCX3 antibody (70R-7415)

Rabbit polyclonal ARMCX3 antibody raised against the middle region of ARMCX3

Synonyms Polyclonal ARMCX3 antibody, Anti-ARMCX3 antibody, ALEX3 antibody, Armadillo Repeat Containing X-Linked 3 antibody, dJ545K15.2 antibody, DKFZp781N1954 antibody, MGC12199 antibody, KIAA0443 antibody
Specificity ARMCX3 antibody was raised against the middle region of ARMCX3
Cross Reactivity Human
Applications WB
Immunogen ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE
Assay Information ARMCX3 Blocking Peptide, catalog no. 33R-4948, is also available for use as a blocking control in assays to test for specificity of this ARMCX3 antibody

Images

Western Blot analysis using ARMCX3 antibody (70R-7415)

ARMCX3 antibody (70R-7415) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARMCX3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARMCX3 is a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ARMCX3 antibody (70R-7415) | ARMCX3 antibody (70R-7415) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors