ARSA antibody (70R-5285)

Rabbit polyclonal ARSA antibody raised against the N terminal of ARSA

Synonyms Polyclonal ARSA antibody, Anti-ARSA antibody, MLD antibody, Arylsulfatase A antibody
Specificity ARSA antibody was raised against the N terminal of ARSA
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ARSA antibody was raised using the N terminal of ARSA corresponding to a region with amino acids DLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVR
Assay Information ARSA Blocking Peptide, catalog no. 33R-2042, is also available for use as a blocking control in assays to test for specificity of this ARSA antibody

Images

Western Blot analysis using ARSA antibody (70R-5285)

ARSA antibody (70R-5285) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARSA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Multiple alternatively spliced transcript variants, one of which encodes a distinct protein, have been described for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ARSA antibody (70R-5285) | ARSA antibody (70R-5285) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors