ARSH antibody (70R-6266)

Rabbit polyclonal ARSH antibody raised against the middle region of ARSH

Synonyms Polyclonal ARSH antibody, Anti-ARSH antibody, Sulfatase antibody, Arylsulfatase Family Member H antibody
Specificity ARSH antibody was raised against the middle region of ARSH
Cross Reactivity Human
Applications WB
Immunogen ARSH antibody was raised using the middle region of ARSH corresponding to a region with amino acids FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG
Assay Information ARSH Blocking Peptide, catalog no. 33R-2924, is also available for use as a blocking control in assays to test for specificity of this ARSH antibody

Images

Western Blot analysis using ARSH antibody (70R-6266)

ARSH antibody (70R-6266) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARSH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ARSH antibody (70R-6266) | ARSH antibody (70R-6266) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors