ART3 antibody (70R-6841)

Rabbit polyclonal ART3 antibody raised against the middle region of ART3

Synonyms Polyclonal ART3 antibody, Anti-ART3 antibody, ART 3, ART3, ART-3 antibody, Adp-Ribosyltransferase 3 antibody, ART 3 antibody, ART-3
Specificity ART3 antibody was raised against the middle region of ART3
Cross Reactivity Human
Applications WB
Immunogen ART3 antibody was raised using the middle region of ART3 corresponding to a region with amino acids LEPTQIPAPGPVPVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVA
Assay Information ART3 Blocking Peptide, catalog no. 33R-4921, is also available for use as a blocking control in assays to test for specificity of this ART3 antibody

Images

Western Blot analysis using ART3 antibody (70R-6841)

ART3 antibody (70R-6841) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ART3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADP-ribosylation is a reversible posttranslational modification used to regulate protein function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ART3 antibody (70R-6841) | ART3 antibody (70R-6841) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors