ART5 antibody (70R-5344)

Rabbit polyclonal ART5 antibody raised against the middle region of ART5

Synonyms Polyclonal ART5 antibody, Anti-ART5 antibody, ART-5 antibody, ART5, MGC22848 antibody, Adp-Ribosyltransferase 5 antibody, ART 5 antibody, ART 5, ART-5
Specificity ART5 antibody was raised against the middle region of ART5
Cross Reactivity Human
Applications WB
Immunogen ART5 antibody was raised using the middle region of ART5 corresponding to a region with amino acids VFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGE
Assay Information ART5 Blocking Peptide, catalog no. 33R-9536, is also available for use as a blocking control in assays to test for specificity of this ART5 antibody

Images

Western Blot analysis using ART5 antibody (70R-5344)

ART5 antibody (70R-5344) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ART5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme. Transcript variants with different 5' UTRs, but encoding the same protein have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ART5 antibody (70R-5344) | ART5 antibody (70R-5344) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors