ARV1 antibody (70R-6453)

Rabbit polyclonal ARV1 antibody

Synonyms Polyclonal ARV1 antibody, Anti-ARV1 antibody, Arv1 Homolog antibody
Cross Reactivity Human
Applications WB
Immunogen ARV1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD
Assay Information ARV1 Blocking Peptide, catalog no. 33R-7461, is also available for use as a blocking control in assays to test for specificity of this ARV1 antibody

Images

Western Blot analysis using ARV1 antibody (70R-6453)

ARV1 antibody (70R-6453) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARV1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARV1 may act as a mediator of sterol homeostasis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ARV1 antibody (70R-6453) | ARV1 antibody (70R-6453) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors