ASB5 antibody (70R-5995)

Rabbit polyclonal ASB5 antibody raised against the C terminal of ASB5

Synonyms Polyclonal ASB5 antibody, Anti-ASB5 antibody, Ankyrin Repeat And Socs Box-Containing 5 antibody
Specificity ASB5 antibody was raised against the C terminal of ASB5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ASB5 antibody was raised using the C terminal of ASB5 corresponding to a region with amino acids LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC
Assay Information ASB5 Blocking Peptide, catalog no. 33R-5157, is also available for use as a blocking control in assays to test for specificity of this ASB5 antibody

Images

Western Blot analysis using ASB5 antibody (70R-5995)

ASB5 antibody (70R-5995) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASB5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance They contain ankyrin repeat sequence and SOCS box domain. The SOCSbox serves to couple suppressor of cytokine signalling (SOCS)proteins and their binding partners with the elongin B and Ccomplex, possibly targeting them for degradation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ASB5 antibody (70R-5995) | ASB5 antibody (70R-5995) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors