ASB6 antibody (70R-5879)

Rabbit polyclonal ASB6 antibody raised against the middle region of ASB6

Synonyms Polyclonal ASB6 antibody, Anti-ASB6 antibody, FLJ20548 antibody, MGC1024 antibody, Ankyrin Repeat And Socs Box-Containing 6 antibody
Specificity ASB6 antibody was raised against the middle region of ASB6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV
Assay Information ASB6 Blocking Peptide, catalog no. 33R-5090, is also available for use as a blocking control in assays to test for specificity of this ASB6 antibody

Images

Western Blot analysis using ASB6 antibody (70R-5879)

ASB6 antibody (70R-5879) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASB6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASB6 belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ASB6 antibody (70R-5879) | ASB6 antibody (70R-5879) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors