ASB7 antibody (70R-3741)

Rabbit polyclonal ASB7 antibody raised against the middle region of ASB7

Synonyms Polyclonal ASB7 antibody, Anti-ASB7 antibody, FLJ22551 antibody, Ankyrin Repeat And Socs Box-Containing 7 antibody
Specificity ASB7 antibody was raised against the middle region of ASB7
Cross Reactivity Human
Applications WB
Immunogen ASB7 antibody was raised using the middle region of ASB7 corresponding to a region with amino acids QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC
Assay Information ASB7 Blocking Peptide, catalog no. 33R-7760, is also available for use as a blocking control in assays to test for specificity of this ASB7 antibody


Western Blot analysis using ASB7 antibody (70R-3741)

ASB7 antibody (70R-3741) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASB7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contains a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. In this way, SOCS box containing proteins may regulate protein turnover by targeting proteins for polyubiquination and, therefore, for proteasome-mediated degradation. Two alternative transcripts encoding different isoforms have been described.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ASB7 antibody (70R-3741) | ASB7 antibody (70R-3741) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors