ASCC2 antibody (70R-3373)

Rabbit polyclonal ASCC2 antibody raised against the middle region of ASCC2

Synonyms Polyclonal ASCC2 antibody, Anti-ASCC2 antibody, ASC1p100 antibody, Activating Signal Cointegrator 1 Complex Subunit 2 antibody
Specificity ASCC2 antibody was raised against the middle region of ASCC2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ASCC2 antibody was raised using the middle region of ASCC2 corresponding to a region with amino acids YEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEEDD
Assay Information ASCC2 Blocking Peptide, catalog no. 33R-10082, is also available for use as a blocking control in assays to test for specificity of this ASCC2 antibody

Images

Western Blot analysis using ASCC2 antibody (70R-3373)

ASCC2 antibody (70R-3373) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASCC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASCC2 belongs to the ASCC2 family. It contains 1 CUE domain. ASCC2 enhances NF-kappa-B, SRF and AP1 transactivation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ASCC2 antibody (70R-3373) | ASCC2 antibody (70R-3373) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors