ASGR1 antibody (70R-1076)

Rabbit polyclonal ASGR1 antibody raised against the N terminal of ASGR1

Synonyms Polyclonal ASGR1 antibody, Anti-ASGR1 antibody, Asialoglycoprotein Receptor 1 antibody
Specificity ASGR1 antibody was raised against the N terminal of ASGR1
Cross Reactivity Human, Dog
Applications WB
Immunogen ASGR1 antibody was raised using the N terminal of ASGR1 corresponding to a region with amino acids RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
Assay Information ASGR1 Blocking Peptide, catalog no. 33R-8004, is also available for use as a blocking control in assays to test for specificity of this ASGR1 antibody


Western Blot analysis using ASGR1 antibody (70R-1076)

ASGR1 antibody (70R-1076) used at 0.6 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ASGR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.6 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ASGR1 antibody (70R-1076) | ASGR1 antibody (70R-1076) used at 0.6 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors