Astrotactin 2 antibody (70R-6099)

Rabbit polyclonal Astrotactin 2 antibody raised against the N terminal of ASTN2

Synonyms Polyclonal Astrotactin 2 antibody, Anti-Astrotactin 2 antibody, KIAA0634 antibody, Astrotactin -2 antibody, Astrotactin 2, ASTN2 antibody, Astrotactin 2 antibody, Astrotactin -2, bA67K19.1 antibody, Astrotactin 2
Specificity Astrotactin 2 antibody was raised against the N terminal of ASTN2
Cross Reactivity Human,Mouse
Applications WB
Immunogen Astrotactin 2 antibody was raised using the N terminal of ASTN2 corresponding to a region with amino acids PGSAGTAAESRLLLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADIS
Assay Information Astrotactin 2 Blocking Peptide, catalog no. 33R-7131, is also available for use as a blocking control in assays to test for specificity of this Astrotactin 2 antibody

Images

Western Blot analysis using Astrotactin 2 antibody (70R-6099)

Astrotactin 2 antibody (70R-6099) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 142 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASTN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASTN2 may play an important role in neuronal functioning.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Astrotactin 2 antibody (70R-6099) | Astrotactin 2 antibody (70R-6099) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors