ASXL2 antibody (70R-3526)

Rabbit polyclonal ASXL2 antibody

Synonyms Polyclonal ASXL2 antibody, Anti-ASXL2 antibody, Additional Sex Combs Like 2 antibody, ASXH2 antibody, KIAA1685 antibody, DKFZp686C1968 antibody, FLJ10898 antibody
Cross Reactivity Human
Applications WB
Immunogen ASXL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS
Assay Information ASXL2 Blocking Peptide, catalog no. 33R-2337, is also available for use as a blocking control in assays to test for specificity of this ASXL2 antibody


Western Blot analysis using ASXL2 antibody (70R-3526)

ASXL2 antibody (70R-3526) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 154 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASXL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASXL2 is a human homolog of the Drosophila asx gene. Drosophila asx is an enhancer of trithorax and polycomb gene that encodes a chromatin protein with dual functions in transcriptional activation and silencing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ASXL2 antibody (70R-3526) | ASXL2 antibody (70R-3526) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors