ATG10 antibody (70R-3584)

Rabbit polyclonal ATG10 antibody

Synonyms Polyclonal ATG10 antibody, Anti-ATG10 antibody, Atg10 Autophagy Related 10 Homolog antibody, ATG-10, ATG 10 antibody, ATG10, FLJ13954 antibody, APG10L antibody, ATG-10 antibody, DKFZP586I0418 antibody, ATG 10, APG10 antibody, pp12616 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ATG10 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP
Assay Information ATG10 Blocking Peptide, catalog no. 33R-9235, is also available for use as a blocking control in assays to test for specificity of this ATG10 antibody


Western Blot analysis using ATG10 antibody (70R-3584)

ATG10 antibody (70R-3584) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATG10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12-ATG5 conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A), a homolog of yeast Apg8, to a membrane-bound form.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ATG10 antibody (70R-3584) | ATG10 antibody (70R-3584) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors