ATG2A antibody (70R-3823)

Rabbit polyclonal ATG2A antibody

Synonyms Polyclonal ATG2A antibody, Anti-ATG2A antibody, KIAA0404 antibody, ATG-2 antibody, ATG2, ATG 2, ATG 2 antibody, MGC117153 antibody, ATG-2, Atg2 Autophagy Related 2 Homolog A antibody
Cross Reactivity Human
Applications WB
Immunogen ATG2A antibody was raised using a synthetic peptide corresponding to a region with amino acids PRRGPAPGAADSQSWASCMTTSLQLAQECLRDGLPEPSEPPQPLEGLEMF
Assay Information ATG2A Blocking Peptide, catalog no. 33R-7339, is also available for use as a blocking control in assays to test for specificity of this ATG2A antibody

Images

Western Blot analysis using ATG2A antibody (70R-3823)

ATG2A antibody (70R-3823) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 213 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATG2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ATG2 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATG2A antibody (70R-3823) | ATG2A antibody (70R-3823) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors