ATG5 antibody (70R-6015)

Rabbit polyclonal ATG5 antibody

Synonyms Polyclonal ATG5 antibody, Anti-ATG5 antibody, Atg5 Autophagy Related 5 Homolog antibody, APG5 antibody, ATG-5, ATG 5, APG5L antibody, ATG-5 antibody, hAPG5 antibody, ASP antibody, ATG 5 antibody, ATG5
Cross Reactivity Human,Mouse
Applications IHC, WB
Immunogen ATG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
Assay Information ATG5 Blocking Peptide, catalog no. 33R-2099, is also available for use as a blocking control in assays to test for specificity of this ATG5 antibody

Images

Immunohistochemical staining using ATG5 antibody (70R-6015)

ATG5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATG5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATG5 is required for autophagy. It conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. ATG5 may play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using ATG5 antibody (70R-6015) | ATG5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using ATG5 antibody (70R-6015) | ATG5 antibody (70R-6015) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using ATG5 antibody (70R-6015) | ATG5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors