ATG9A antibody (70R-6415)

Rabbit polyclonal ATG9A antibody

Synonyms Polyclonal ATG9A antibody, Anti-ATG9A antibody, ATG-9 antibody, Atg9 Autophagy Related 9 Homolog A antibody, ATG9, ATG 9 antibody, ATG-9, APG9L1 antibody, ATG 9, MGD3208 antibody
Cross Reactivity Human
Applications WB
Immunogen ATG9A antibody was raised using a synthetic peptide corresponding to a region with amino acids VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV
Assay Information ATG9A Blocking Peptide, catalog no. 33R-9437, is also available for use as a blocking control in assays to test for specificity of this ATG9A antibody

Images

Western Blot analysis using ATG9A antibody (70R-6415)

ATG9A antibody (70R-6415) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATG9A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATG9A belongs to the ATG9 family. It plays a role in autophagy.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATG9A antibody (70R-6415) | ATG9A antibody (70R-6415) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors