ATIC antibody (70R-1236)

Rabbit polyclonal ATIC antibody raised against the N terminal of ATIC

Synonyms Polyclonal ATIC antibody, Anti-ATIC antibody, PURH antibody, AICAR antibody, 5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/Imp Cyclohydrolase antibody, AICARFT antibody, IMPCHASE antibody
Specificity ATIC antibody was raised against the N terminal of ATIC
Cross Reactivity Human,Mouse
Applications WB
Immunogen ATIC antibody was raised using the N terminal of ATIC corresponding to a region with amino acids YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG
Assay Information ATIC Blocking Peptide, catalog no. 33R-10290, is also available for use as a blocking control in assays to test for specificity of this ATIC antibody

Images

Western Blot analysis using ATIC antibody (70R-1236)

ATIC antibody (70R-1236) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ATIC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATIC is a bifunctional protein requiring dimerization for transformylase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATIC antibody (70R-1236) | ATIC antibody (70R-1236) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors