ATIC antibody (70R-1295)

Rabbit polyclonal ATIC antibody raised against the middle region of ATIC

Synonyms Polyclonal ATIC antibody, Anti-ATIC antibody, FLJ93545 antibody, AICARFT antibody, 5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/Imp Cyclohydrolase antibody, PURH antibody, IMPCHASE antibody, AICAR antibody
Specificity ATIC antibody was raised against the middle region of ATIC
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT
Assay Information ATIC Blocking Peptide, catalog no. 33R-8229, is also available for use as a blocking control in assays to test for specificity of this ATIC antibody

Images

Western Blot analysis using ATIC antibody (70R-1295)

ATIC antibody (70R-1295) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ATIC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATIC is a bifunctional protein requiring dimerization for transformylase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATIC antibody (70R-1295) | ATIC antibody (70R-1295) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using ATIC antibody (70R-1295) | ATIC antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors