ATL3 antibody (70R-5965)

Rabbit polyclonal ATL3 antibody raised against the middle region of Dkfzp564J0863

Synonyms Polyclonal ATL3 antibody, Anti-ATL3 antibody, ATL 3, ATL 3 antibody, ATL3, Atlastin 3 like antibody, FZp564J0863 antibody, Atlastin GTPase 3 antibody, AI465397 antibody, ATL-3 antibody, AW228836 antibody, 4633402C03Rik antibody, MGC28761 antibody, ATL-3, 5730596K20Rik antibody
Specificity ATL3 antibody was raised against the middle region of Dkfzp564J0863
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ATL3 antibody was raised using the middle region of Dkfzp564J0863 corresponding to a region with amino acids IYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSF
Assay Information ATL3 Blocking Peptide, catalog no. 33R-4230, is also available for use as a blocking control in assays to test for specificity of this ATL3 antibody


Western Blot analysis using ATL3 antibody (70R-5965)

ATL3 antibody (70R-5965) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DKFZP564J0863 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of DKFZP564J0863 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ATL3 antibody (70R-5965) | ATL3 antibody (70R-5965) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors