ATP10D antibody (70R-6896)

Rabbit polyclonal ATP10D antibody raised against the C terminal of ATP10D

Synonyms Polyclonal ATP10D antibody, Anti-ATP10D antibody, ATPVD antibody, Atpase Class V Type 10D antibody, KIAA1487 antibody
Specificity ATP10D antibody was raised against the C terminal of ATP10D
Cross Reactivity Human
Applications WB
Immunogen ATP10D antibody was raised using the C terminal of ATP10D corresponding to a region with amino acids LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA
Assay Information ATP10D Blocking Peptide, catalog no. 33R-4952, is also available for use as a blocking control in assays to test for specificity of this ATP10D antibody

Images

Western Blot analysis using ATP10D antibody (70R-6896)

ATP10D antibody (70R-6896) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 160 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP10D antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATP10D is a multi-pass membrane protein. It belongs to the cation transport ATPase (P-type) family, type IV subfamily. The exact function of ATP10D remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATP10D antibody (70R-6896) | ATP10D antibody (70R-6896) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors